SCOPe 2.08: Domain d6i5fb1: 6i5f B:6-116

Lineage for d6i5fb1 (6i5f B:6-116)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families)
   automatically mapped to Pfam PF01624

5. Family d.75.2.0: automated matches [254200] (1 protein)
   not a true family

6. Protein automated matches [254440] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [254937] (3 PDB entries)

8. Domain d6i5fb1: 6i5f B:6-116 [372917]
   Other proteins in same PDB: d6i5fa2, d6i5fa3, d6i5fa4, d6i5fb2, d6i5fb3, d6i5fb4
   automated match to d1w7aa4
   complexed with adp, gol, so4; mutant

Details for d6i5fb1

PDB Entry: 6i5f, 2.6 Å

PDB Description: crystal structure of dna-free e.coli muts p839e dimer mutant

PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d6i5fb1:

Sequence, based on SEQRES records:

>d6i5fb1 d.75.2.0 (B:6-116) automated matches {Escherichia coli [TaxId: 562]}
nfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagep
ipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

Sequence, based on observed residues (ATOM records):

>d6i5fb1 d.75.2.0 (B:6-116) automated matches {Escherichia coli [TaxId: 562]}
nfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagep
ipmagipyhavenylaklvnqgesvaicegpverkvvrivtp

Timeline for d6i5fb1:

• d6i5fb1 first appeared in SCOPe 2.07