Lineage for d6i5fb1 (6i5f B:6-116)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958349Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2958380Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) (S)
    automatically mapped to Pfam PF01624
  5. 2958406Family d.75.2.0: automated matches [254200] (1 protein)
    not a true family
  6. 2958407Protein automated matches [254440] (1 species)
    not a true protein
  7. 2958408Species Escherichia coli [TaxId:562] [254937] (3 PDB entries)
  8. 2958412Domain d6i5fb1: 6i5f B:6-116 [372917]
    Other proteins in same PDB: d6i5fa2, d6i5fa3, d6i5fa4, d6i5fb2, d6i5fb3, d6i5fb4
    automated match to d1w7aa4
    complexed with adp, gol, so4; mutant

Details for d6i5fb1

PDB Entry: 6i5f (more details), 2.6 Å

PDB Description: crystal structure of dna-free e.coli muts p839e dimer mutant
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d6i5fb1:

Sequence, based on SEQRES records: (download)

>d6i5fb1 d.75.2.0 (B:6-116) automated matches {Escherichia coli [TaxId: 562]}
nfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagep
ipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

Sequence, based on observed residues (ATOM records): (download)

>d6i5fb1 d.75.2.0 (B:6-116) automated matches {Escherichia coli [TaxId: 562]}
nfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagep
ipmagipyhavenylaklvnqgesvaicegpverkvvrivtp

SCOPe Domain Coordinates for d6i5fb1:

Click to download the PDB-style file with coordinates for d6i5fb1.
(The format of our PDB-style files is described here.)

Timeline for d6i5fb1: