Lineage for d1rnfa_ (1rnf A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1015692Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1015693Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1015694Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1015769Protein Ribonuclease 4 [54092] (1 species)
  7. 1015770Species Human (Homo sapiens) [TaxId:9606] [54093] (2 PDB entries)
  8. 1015771Domain d1rnfa_: 1rnf A: [37291]

Details for d1rnfa_

PDB Entry: 1rnf (more details), 2.1 Å

PDB Description: x-ray crystal structure of unliganded human ribonuclease 4
PDB Compounds: (A:) protein (ribonuclease 4)

SCOPe Domain Sequences for d1rnfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rnfa_ d.5.1.1 (A:) Ribonuclease 4 {Human (Homo sapiens) [TaxId: 9606]}
mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg

SCOPe Domain Coordinates for d1rnfa_:

Click to download the PDB-style file with coordinates for d1rnfa_.
(The format of our PDB-style files is described here.)

Timeline for d1rnfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rnfb_