Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Lactococcus lactis [TaxId:272623] [227880] (6 PDB entries) |
Domain d6h30a2: 6h30 A:255-483 [372881] automated match to d1hsla_ complexed with 1pe, mes, pe5, peg, pg4, pge |
PDB Entry: 6h30 (more details), 2.8 Å
SCOPe Domain Sequences for d6h30a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h30a2 c.94.1.0 (A:255-483) automated matches {Lactococcus lactis [TaxId: 272623]} atpkkdvytiasdnsfapfefqnddkqftgidvdllnaiaknqgfklkwnfigfqaavds vqsghadgmmsgmsitdarkqvfdygspyyssnltiatsstddsikswkdlkgktlgakn gtasfdylnahakeygytvktftdattmysslnngsinalmddepvikyaikqgqkfatp ikpipdgqygfavkkgsnpeliemfnnglanlrangeydkiidkylesd
Timeline for d6h30a2: