PDB entry 6h30

View 6h30 on RCSB PDB site
Description: The crystal structure of SBD1-SBD2 tandem of GlnPQ transporter
Class: transport protein
Keywords: glutamine binding protein, amino acid transport, transport protein
Deposited on 2018-07-17, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamine ABC transporter permease and substrate binding protein protein
    Species: LACTOCOCCUS LACTIS SUBSP. LACTIS IL1403 [TaxId:272623]
    Gene: glnP, L165
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h30a1, d6h30a2
  • Chain 'B':
    Compound: Glutamine ABC transporter permease and substrate binding protein protein
    Species: LACTOCOCCUS LACTIS SUBSP. LACTIS IL1403 [TaxId:272623]
    Gene: glnP, L165
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h30b1, d6h30b2
  • Heterogens: PEG, MES, PG4, 1PE, PE5, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h30A (A:)
    gmettvkiasdssyapfefqngqkkwvgidvdimqevakindwklemsypgfdaalqnlk
    agqvdgiiagmtitderketfdfsnpyytsaltiattkdsklsdysdlkgkavgakngta
    aqtwlqenqkkygytiktysdgvhmfaalssgniagamdevpvisyamkqgqdlamnfps
    islpggygfavmkgknstlvdgfnkalaemksngdydkilkkygitatkkatpkkdvyti
    asdnsfapfefqnddkqftgidvdllnaiaknqgfklkwnfigfqaavdsvqsghadgmm
    sgmsitdarkqvfdygspyyssnltiatsstddsikswkdlkgktlgakngtasfdylna
    hakeygytvktftdattmysslnngsinalmddepvikyaikqgqkfatpikpipdgqyg
    favkkgsnpeliemfnnglanlrangeydkiidkylesda
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h30A (A:)
    ttvkiasdssyapfefqngqkkwvgidvdimqevakindwklemsypgfdaalqnlkagq
    vdgiiagmtitderketfdfsnpyytsaltiattkdsklsdysdlkgkavgakngtaaqt
    wlqenqkkygytiktysdgvhmfaalssgniagamdevpvisyamkqgqdlamnfpsisl
    pggygfavmkgknstlvdgfnkalaemksngdydkilkkygitatkkatpkkdvytiasd
    nsfapfefqnddkqftgidvdllnaiaknqgfklkwnfigfqaavdsvqsghadgmmsgm
    sitdarkqvfdygspyyssnltiatsstddsikswkdlkgktlgakngtasfdylnahak
    eygytvktftdattmysslnngsinalmddepvikyaikqgqkfatpikpipdgqygfav
    kkgsnpeliemfnnglanlrangeydkiidkylesd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h30B (B:)
    gmettvkiasdssyapfefqngqkkwvgidvdimqevakindwklemsypgfdaalqnlk
    agqvdgiiagmtitderketfdfsnpyytsaltiattkdsklsdysdlkgkavgakngta
    aqtwlqenqkkygytiktysdgvhmfaalssgniagamdevpvisyamkqgqdlamnfps
    islpggygfavmkgknstlvdgfnkalaemksngdydkilkkygitatkkatpkkdvyti
    asdnsfapfefqnddkqftgidvdllnaiaknqgfklkwnfigfqaavdsvqsghadgmm
    sgmsitdarkqvfdygspyyssnltiatsstddsikswkdlkgktlgakngtasfdylna
    hakeygytvktftdattmysslnngsinalmddepvikyaikqgqkfatpikpipdgqyg
    favkkgsnpeliemfnnglanlrangeydkiidkylesda
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h30B (B:)
    ttvkiasdssyapfefqngqkkwvgidvdimqevakindwklemsypgfdaalqnlkagq
    vdgiiagmtitderketfdfsnpyytsaltiattkdsklsdysdlkgkavgakngtaaqt
    wlqenqkkygytiktysdgvhmfaalssgniagamdevpvisyamkqgqdlamnfpsisl
    pggygfavmkgknstlvdgfnkalaemksngdydkilkkygitatkkatpkkdvytiasd
    nsfapfefqnddkqftgidvdllnaiaknqgfklkwnfigfqaavdsvqsghadgmmsgm
    sitdarkqvfdygspyyssnltiatsstddsikswkdlkgktlgakngtasfdylnahak
    eygytvktftdattmysslnngsinalmddepvikyaikqgqkfatpikpipdgqygfav
    kkgsnpeliemfnnglanlrangeydkiidkyle