SCOPe 2.07: Domain d6h30b1: 6h30 B:28-254

Lineage for d6h30b1 (6h30 B:28-254)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:272623] [227880] (6 PDB entries)

8. Domain d6h30b1: 6h30 B:28-254 [372854]
   automated match to d1hsla_
   complexed with 1pe, mes, pe5, peg, pg4, pge

Details for d6h30b1

PDB Entry: 6h30, 2.8 Å

PDB Description: the crystal structure of sbd1-sbd2 tandem of glnpq transporter

PDB Compounds: (B:) Glutamine ABC transporter permease and substrate binding protein protein

SCOPe Domain Sequences for d6h30b1:

Sequence; same for both SEQRES and ATOM records:

>d6h30b1 c.94.1.0 (B:28-254) automated matches {Lactococcus lactis [TaxId: 272623]}
ttvkiasdssyapfefqngqkkwvgidvdimqevakindwklemsypgfdaalqnlkagq
vdgiiagmtitderketfdfsnpyytsaltiattkdsklsdysdlkgkavgakngtaaqt
wlqenqkkygytiktysdgvhmfaalssgniagamdevpvisyamkqgqdlamnfpsisl
pggygfavmkgknstlvdgfnkalaemksngdydkilkkygitatkk

Timeline for d6h30b1:

• d6h30b1 is new in SCOPe 2.07-stable
  
• d6h30b1 appears in the current release, SCOPe 2.08