SCOP 1.57: Domain d11bab_: 11ba B:

Lineage for d11bab_ (11ba B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Seminal ribonucleasease [54086] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54087] (3 PDB entries)

8. Domain d11bab_: 11ba B: [37285]

Details for d11bab_

PDB Entry: 11ba, 2.06 Å

PDB Description: binding of a substrate analogue to a domain swapping protein in the complex of bovine seminal ribonuclease with uridylyl-2',5'-adenosine

SCOP Domain Sequences for d11bab_:

Sequence; same for both SEQRES and ATOM records:

>d11bab_ d.5.1.1 (B:) Seminal ribonucleasease {Cow (Bos taurus)}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

Timeline for d11bab_:

• d11bab_ first appeared (with stable ids) in SCOP 1.55
  
• d11bab_ appears in SCOP 1.59
  
• d11bab_ appears in the current release, SCOPe 2.08