Lineage for d11bab_ (11ba B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) Fold d.5: RNase A-like [54075] (1 superfamily) Superfamily d.5.1: RNase A-like [54076] (1 family) 
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) 
Protein Seminal ribonucleasease [54086] (1 species) Species Cow (Bos taurus) [TaxId:9913] [54087] (3 PDB entries) 
Domain d11bab_: 11ba B: [37285]
Details for d11bab_
PDB Entry: 11ba (more details), 2.06 Å
PDB Description: binding of a substrate analogue to a domain swapping protein in the complex of bovine seminal ribonuclease with uridylyl-2',5'-adenosine
SCOP Domain Sequences for d11bab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d11bab_ d.5.1.1 (B:) Seminal ribonucleasease {Cow (Bos taurus)}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv
SCOP Domain Coordinates for d11bab_:
Click to download the PDB-style file with coordinates for d11bab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d11bab_:
- d11bab_ appears in SCOP 1.57
- d11bab_ appears in the current release, SCOPe 2.08
View in 3D
