Lineage for d1bc4__ (1bc4 -)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 406879Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 406880Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulfide-rich
  5. 406881Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 406882Protein Amphibian cytotoxic ribonuclease [54084] (4 species)
  7. 406883Species Bullfrog (Rana catesbeiana) [TaxId:8400] [54085] (4 PDB entries)
  8. 406888Domain d1bc4__: 1bc4 - [37279]

Details for d1bc4__

PDB Entry: 1bc4 (more details)

PDB Description: the solution structure of a cytotoxic ribonuclease from the oocytes of rana catesbeiana (bullfrog), nmr, 15 structures

SCOP Domain Sequences for d1bc4__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bc4__ d.5.1.1 (-) Amphibian cytotoxic ribonuclease {Bullfrog (Rana catesbeiana)}
enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp

SCOP Domain Coordinates for d1bc4__:

Click to download the PDB-style file with coordinates for d1bc4__.
(The format of our PDB-style files is described here.)

Timeline for d1bc4__: