Lineage for d1bc4__ (1bc4 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29802Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 29803Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 29804Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 29818Protein Cytotoxic ribonuclease [54084] (1 species)
  7. 29819Species Bullfrog (Rana catesbeiana) [TaxId:8400] [54085] (1 PDB entry)
  8. 29820Domain d1bc4__: 1bc4 - [37279]

Details for d1bc4__

PDB Entry: 1bc4 (more details)

PDB Description: the solution structure of a cytotoxic ribonuclease from the oocytes of rana catesbeiana (bullfrog), nmr, 15 structures

SCOP Domain Sequences for d1bc4__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bc4__ d.5.1.1 (-) Cytotoxic ribonuclease {Bullfrog (Rana catesbeiana)}
enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp

SCOP Domain Coordinates for d1bc4__:

Click to download the PDB-style file with coordinates for d1bc4__.
(The format of our PDB-style files is described here.)

Timeline for d1bc4__: