SCOP 1.55: Domain d1bc4__: 1bc4 -

Lineage for d1bc4__ (1bc4 -)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Cytotoxic ribonuclease [54084] (1 species)

7. Species Bullfrog (Rana catesbeiana) [TaxId:8400] [54085] (1 PDB entry)

8. Domain d1bc4__: 1bc4 - [37279]

Details for d1bc4__

PDB Entry: 1bc4

PDB Description: the solution structure of a cytotoxic ribonuclease from the oocytes of rana catesbeiana (bullfrog), nmr, 15 structures

SCOP Domain Sequences for d1bc4__:

Sequence; same for both SEQRES and ATOM records:

>d1bc4__ d.5.1.1 (-) Cytotoxic ribonuclease {Bullfrog (Rana catesbeiana)}
enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp

Timeline for d1bc4__:

• d1bc4__ appears in SCOP 1.57
  
• d1bc4__ appears in the current release, SCOPe 2.08, called d1bc4a_