Lineage for d1dzaa_ (1dza A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. Species Human (Homo sapiens), des1-7 [TaxId:9606] [54080] (8 PDB entries)
  8. Domain d1dzaa_: 1dza A: [37275]
    designed cytotoxic mutant

Details for d1dzaa_

PDB Entry: 1dza (more details), 1.6500000000000001 Å

PDB Description: 3-d structure of a hp-rnase
PDB Compounds: (A:) ribonuclease 1

SCOPe Domain Sequences for d1dzaa_:

Sequence, based on SEQRES records: (download)

>d1dzaa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]}
mkesaaakferqhmdsgnspsssstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcf
qekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvh
fdasve

Sequence, based on observed residues (ATOM records): (download)

>d1dzaa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]}
mkesaaakferqhmdsgnstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcfqekvt
ckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasv
e

SCOPe Domain Coordinates for d1dzaa_ are not available.

Timeline for d1dzaa_:

Domains from other chains:
(mouse over for more information)
d1dzab_