Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Streptoalloteichus hindustanus [TaxId:2017] [372525] (4 PDB entries) |
Domain d6j85a_: 6j85 A: [372591] automated match to d4z5qa_ complexed with hem |
PDB Entry: 6j85 (more details), 2.2 Å
SCOPe Domain Sequences for d6j85a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j85a_ a.104.1.0 (A:) automated matches {Streptoalloteichus hindustanus [TaxId: 2017]} tpapvrypfgeavrldlhptyaelrerrtllrvrvphgddawlvtrhedvrtvltdprfs raaaagrdearltplvirtsvmgvdppdhtrlrrlvatafsrrgvehlrpgitalvrrlt ddmvgqgppvdlvrsfvtplsglvicdllgvpyadrsrfrhwleaffsitalpadevavr ieamygyiaelvalrraeptedllgglvrardrdgscseeelvdlanvlllagyhttasq lasslfvlltqpehaellrsrpelapraveellryvpliahvtfaryatedvwlggtlvr ageavlpavpsanrdaevfdepdrldltrrhnphlafghglhhclgaslvrvqmevaltm llgrfpdlalaappdevpwtrgmqarsplrlpvtw
Timeline for d6j85a_: