SCOPe 2.08: Domain d6ihsa1: 6ihs A:1-241

Lineage for d6ihsa1 (6ihs A:1-241)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.219: PP2C-like [81607] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; antiparallel beta sheets

4. Superfamily d.219.1: PP2C-like [81606] (2 families)
   contain binuclear metal (Mn) centre

5. Family d.219.1.0: automated matches [191371] (1 protein)
   not a true family

6. Protein automated matches [190449] (7 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [321697] (7 PDB entries)

8. Domain d6ihsa1: 6ihs A:1-241 [372516]
   Other proteins in same PDB: d6ihsa2
   automated match to d2j82a_
   complexed with mg; mutant

Details for d6ihsa1

PDB Entry: 6ihs, 1.4 Å

PDB Description: crystal structure of bacterial serine phosphatase with his-tag mutation

PDB Compounds: (A:) Phosphorylated protein phosphatase

SCOPe Domain Sequences for d6ihsa1:

Sequence; same for both SEQRES and ATOM records:

>d6ihsa1 d.219.1.0 (A:1-241) automated matches {Staphylococcus aureus [TaxId: 1280]}
eaqfftdtgqhrdknedaggifynqtnqqllvlcdgmgghkagevaskfvtdelksrfea
enlieqhqaenwlrnnikdinfqlyhyaqenaeykgmgttcvcalvfeksvvianvgdsr
ayvinsrqieqitsdhsfvnhlvltgqitpeeafthpqrniitkvmgtdkrvspdlfikr
lnfydylllnsdgltdyvkdneikrllvkegtiedhgdqlmqlaldnhskdnvtfilaai
e

Timeline for d6ihsa1:

• d6ihsa1 first appeared in SCOPe 2.07