Lineage for d2j82a_ (2j82 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007405Fold d.219: PP2C-like [81607] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; antiparallel beta sheets
  4. 3007406Superfamily d.219.1: PP2C-like [81606] (2 families) (S)
    contain binuclear metal (Mn) centre
  5. 3007425Family d.219.1.0: automated matches [191371] (1 protein)
    not a true family
  6. 3007426Protein automated matches [190449] (7 species)
    not a true protein
  7. 3007449Species Synechococcus elongatus [TaxId:32046] [188245] (4 PDB entries)
  8. 3007450Domain d2j82a_: 2j82 A: [165940]
    automated match to d1txoa_
    complexed with ca, mg

Details for d2j82a_

PDB Entry: 2j82 (more details), 1.28 Å

PDB Description: structural analysis of the pp2c family phosphatase tppha from thermosynechococcus elongatus
PDB Compounds: (A:) protein serine-threonine phosphatase

SCOPe Domain Sequences for d2j82a_:

Sequence, based on SEQRES records: (download)

>d2j82a_ d.219.1.0 (A:) automated matches {Synechococcus elongatus [TaxId: 32046]}
mdvagltdcglirksnqdafyidekhqrffivadgmgghaggeeasrlavdhirqyleth
ledlqhdpvtllrqaflaanhaiveqqrqnsaradmgttavvilldekgdrawcahvgds
riyrwrkdqlqqitsdhtwiaqavqlgsltieqarqhpwrhvlsqclgredlsqidiqpi
dlepgdrlllcsdglteeltddvisiylsepnvqkaaaalvdaakthggrdnvtvvvisv

Sequence, based on observed residues (ATOM records): (download)

>d2j82a_ d.219.1.0 (A:) automated matches {Synechococcus elongatus [TaxId: 32046]}
mdvagltdcglirksnqdafyidekhqrffivadgmaggeeasrlavdhirqylethled
lqhdpvtllrqaflaanhaiveqqrqnsaradmgttavvilldekgdrawcahvgdsriy
rwrkdqlqqitsdhtwiaqarhvlsqclgredlsqidiqpidlepgdrlllcsdglteel
tddvisiylsepnvqkaaaalvdaakthggrdnvtvvvisv

SCOPe Domain Coordinates for d2j82a_:

Click to download the PDB-style file with coordinates for d2j82a_.
(The format of our PDB-style files is described here.)

Timeline for d2j82a_: