SCOPe 2.08: Domain d6ihra1: 6ihr A:1-245

Lineage for d6ihra1 (6ihr A:1-245)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.219: PP2C-like [81607] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; antiparallel beta sheets

4. Superfamily d.219.1: PP2C-like [81606] (2 families)
   contain binuclear metal (Mn) centre

5. Family d.219.1.0: automated matches [191371] (1 protein)
   not a true family

6. Protein automated matches [190449] (7 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [321697] (7 PDB entries)

8. Domain d6ihra1: 6ihr A:1-245 [372510]
   Other proteins in same PDB: d6ihra2
   automated match to d2j82a_
   complexed with mg, po4

Details for d6ihra1

PDB Entry: 6ihr, 1.35 Å

PDB Description: crystal structure of bacterial serine phosphatase with his tag

PDB Compounds: (A:) Phosphorylated protein phosphatase

SCOPe Domain Sequences for d6ihra1:

Sequence; same for both SEQRES and ATOM records:

>d6ihra1 d.219.1.0 (A:1-245) automated matches {Staphylococcus aureus [TaxId: 1280]}
eaqfftdtgqhrdknedaggifynqtnqqllvlcdgmgghkagevaskfvtdelksrfea
enlieqhqaenwlrnnikdinfqlyhyaqenaeykgmgttcvcalvfeksvvianvgdsr
ayvinsrqieqitsdhsfvnhlvltgqitpeeafthpqrniitkvmgtdkrvspdlfikr
lnfydylllnsdgltdyvkdneikrllvkegtiedhgdqlmqlaldnhskdnvtfilaai
egdkv

Timeline for d6ihra1:

• d6ihra1 first appeared in SCOPe 2.07