![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries) |
![]() | Domain d1ssb.1: 1ssb A:,B: [37246] complexed with so4 |
PDB Entry: 1ssb (more details), 2 Å
SCOPe Domain Sequences for d1ssb.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1ssb.1 d.5.1.1 (A:,B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]} ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnXpyvpvh ydasv
Timeline for d1ssb.1: