Lineage for d5zjfl1 (5zjf L:1-159)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452663Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2452702Protein Lactate dehydrogenase [51859] (19 species)
  7. 2452768Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (38 PDB entries)
  8. 2452930Domain d5zjfl1: 5zjf L:1-159 [372145]
    Other proteins in same PDB: d5zjfa2, d5zjfb2, d5zjfc2, d5zjfd2, d5zjfe2, d5zjff2, d5zjfg2, d5zjfh2, d5zjfi2, d5zjfj2, d5zjfk2, d5zjfl2
    automated match to d4jnka1
    complexed with 9g9

Details for d5zjfl1

PDB Entry: 5zjf (more details), 2.6 Å

PDB Description: ldha-ma
PDB Compounds: (L:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5zjfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zjfl1 c.2.1.5 (L:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d5zjfl1:

Click to download the PDB-style file with coordinates for d5zjfl1.
(The format of our PDB-style files is described here.)

Timeline for d5zjfl1: