| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (19 species) |
| Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (38 PDB entries) |
| Domain d5zjfl1: 5zjf L:1-159 [372145] Other proteins in same PDB: d5zjfa2, d5zjfb2, d5zjfc2, d5zjfd2, d5zjfe2, d5zjff2, d5zjfg2, d5zjfh2, d5zjfi2, d5zjfj2, d5zjfk2, d5zjfl2 automated match to d4jnka1 complexed with 9g9 |
PDB Entry: 5zjf (more details), 2.6 Å
SCOPe Domain Sequences for d5zjfl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zjfl1 c.2.1.5 (L:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig
Timeline for d5zjfl1: