Lineage for d5zjdb2 (5zjd B:160-331)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2604674Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2604681Protein Lactate dehydrogenase [56339] (20 species)
  7. 2604752Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (38 PDB entries)
  8. 2604878Domain d5zjdb2: 5zjd B:160-331 [372130]
    Other proteins in same PDB: d5zjda1, d5zjdb1, d5zjdc1, d5zjdd1, d5zjde1, d5zjdf1, d5zjdg1, d5zjdh1
    automated match to d4jnka2
    complexed with mli, nai

Details for d5zjdb2

PDB Entry: 5zjd (more details), 2.39 Å

PDB Description: lactate dehydrogenase with nadh and mla
PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5zjdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zjdb2 d.162.1.1 (B:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d5zjdb2:

Click to download the PDB-style file with coordinates for d5zjdb2.
(The format of our PDB-style files is described here.)

Timeline for d5zjdb2: