SCOPe 2.08: Domain d6rfnb_: 6rfn B:

Lineage for d6rfnb_ (6rfn B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries)

8. Domain d6rfnb_: 6rfn B: [372119]
   automated match to d4i15a_
   complexed with fmt, gai, gol, k3w, mg, zn

Details for d6rfnb_

PDB Entry: 6rfn, 2.29 Å

PDB Description: crystal structure of t. brucei pde-b1 catalytic domain with inhibitor npd-1018

PDB Compounds: (B:) phosphodiesterase

SCOPe Domain Sequences for d6rfnb_:

Sequence; same for both SEQRES and ATOM records:

>d6rfnb_ a.211.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
fqkivdaclqgmqwtvdriksnraqwervlet

Timeline for d6rfnb_:

• d6rfnb_ first appeared in SCOPe 2.07