Lineage for d1afkb_ (1afk B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597438Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 597439Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulfide-rich
  5. 597440Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 597507Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 597508Species Cow (Bos taurus) [TaxId:9913] [54079] (125 PDB entries)
  8. 597565Domain d1afkb_: 1afk B: [37200]
    complexed with pap

Details for d1afkb_

PDB Entry: 1afk (more details), 1.7 Å

PDB Description: crystal structure of ribonuclease a in complex with 5'-diphosphoadenosine-3'-phosphate

SCOP Domain Sequences for d1afkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afkb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOP Domain Coordinates for d1afkb_:

Click to download the PDB-style file with coordinates for d1afkb_.
(The format of our PDB-style files is described here.)

Timeline for d1afkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1afka_