Lineage for d1afkb_ (1afk B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) Fold d.5: RNase A-like [54075] (1 superfamily) Superfamily d.5.1: RNase A-like [54076] (1 family) 
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species) Species Cow (Bos taurus) [TaxId:9913] [54079] (93 PDB entries) 
Domain d1afkb_: 1afk B: [37200]
Details for d1afkb_
PDB Entry: 1afk (more details), 1.7 Å
PDB Description: crystal structure of ribonuclease a in complex with 5'-diphosphoadenosine-3'-phosphate
SCOP Domain Sequences for d1afkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afkb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv
SCOP Domain Coordinates for d1afkb_:
Click to download the PDB-style file with coordinates for d1afkb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1afkb_:
- d1afkb_ appears in SCOP 1.57
- d1afkb_ appears in the current release, SCOPe 2.08
View in 3D
