SCOPe 2.08: Domain d6isqb1: 6isq B:1-317

Lineage for d6isqb1 (6isq B:1-317)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.17: Fungal lipases [53558] (5 proteins)

6. Protein automated matches [190510] (9 species)
   not a true protein

7. Species Pseudozyma antarctica [TaxId:84753] [371852] (8 PDB entries)

8. Domain d6isqb1: 6isq B:1-317 [371859]
   Other proteins in same PDB: d6isqa2, d6isqb2
   automated match to d5a6va_
   complexed with act, csd, edo, ipa, pge; mutant

Details for d6isqb1

PDB Entry: 6isq, 1.86 Å

PDB Description: structure of lipase mutant with oxided cys-his-asp catalytic triad

PDB Compounds: (B:) lipase b

SCOPe Domain Sequences for d6isqb1:

Sequence; same for both SEQRES and ATOM records:

>d6isqb1 c.69.1.17 (B:1-317) automated matches {Pseudozyma antarctica [TaxId: 84753]}
lpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplsaqlg
ytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltvcqgglvaqwgltffps
irskvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqivptt
nlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrsa
lrsttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepdlmpy
arpfavgkrtcsgivtp

Timeline for d6isqb1:

• d6isqb1 first appeared in SCOPe 2.07