SCOPe 2.07: Domain d6redt2: 6red T:151-435

Lineage for d6redt2 (6red T:151-435)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Polytomella sp. [TaxId:37502] [371490] (10 PDB entries)

8. Domain d6redt2: 6red T:151-435 [371565]
   Other proteins in same PDB: d6reds_, d6redt1, d6redt3
   automated match to d5cdfa2
   complexed with adp, atp, mg

Details for d6redt2

PDB Entry: 6red, 3 Å

PDB Description: cryo-em structure of polytomella f-atp synthase, rotary substate 3a, focussed refinement of f1 head and rotor

PDB Compounds: (T:) ATP synthase subunit alpha

SCOPe Domain Sequences for d6redt2:

Sequence; same for both SEQRES and ATOM records:

>d6redt2 c.37.1.0 (T:151-435) automated matches {Polytomella sp. [TaxId: 37502]}
vnvpigpgtlgrvtdglgqpidgkgpltnvrsslvevkapgiiarqsvreplftgvkavd
alvpigrgqreliigdrqtgktavaidaiihqkncneqvpkaqrvycvyvavgqkrstva
qlvklftqtgamrytimvsatasdaaplqflapysgcamaeyfrdtgkhgliiyddlskq
svayrqmslllrrppgreafpgdvfylhsrlleraaklskelgggsltafpvietqagdv
sayiatnvisitdgqifletelfykgirpalnvglsvsrvgsaaq

Timeline for d6redt2:

• d6redt2 is new in SCOPe 2.07-stable
  
• d6redt2 appears in the current release, SCOPe 2.08