SCOPe 2.07: Domain d6re4t3: 6re4 T:436-562

Lineage for d6re4t3 (6re4 T:436-562)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Polytomella sp. [TaxId:37502] [371492] (10 PDB entries)

8. Domain d6re4t3: 6re4 T:436-562 [371548]
   Other proteins in same PDB: d6re4s_, d6re4t1, d6re4t2
   automated match to d5cdfa3
   complexed with adp, atp, mg

Details for d6re4t3

PDB Entry: 6re4, 3 Å

PDB Description: cryo-em structure of polytomella f-atp synthase, rotary substate 2b, focussed refinement of f1 head and rotor

PDB Compounds: (T:) ATP synthase subunit alpha

SCOPe Domain Sequences for d6re4t3:

Sequence; same for both SEQRES and ATOM records:

>d6re4t3 a.69.1.0 (T:436-562) automated matches {Polytomella sp. [TaxId: 37502]}
fpgmkqvagtlklelaqyrevaafaqfgsdldaatqyvlergarltemlkqkqfapipie
rqtvavyaatkgfldkvrvqdivaaeeavisqvnpavfkilkangkitpaldahlkaelr
kvklpga

Timeline for d6re4t3:

• d6re4t3 is new in SCOPe 2.07-stable
  
• d6re4t3 appears in the current release, SCOPe 2.08