Lineage for d1uch__ (1uch -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597009Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 597010Superfamily d.3.1: Cysteine proteinases [54001] (12 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 597299Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-l3 [54050] (1 protein)
  6. 597300Protein Ubiquitin carboxyl-terminal hydrolase UCH-l3 [54051] (2 species)
  7. 597301Species Human (Homo sapiens) [TaxId:9606] [54052] (2 PDB entries)
  8. 597304Domain d1uch__: 1uch - [37129]

Details for d1uch__

PDB Entry: 1uch (more details), 1.8 Å

PDB Description: deubiquitinating enzyme uch-l3 (human) at 1.8 angstrom resolution

SCOP Domain Sequences for d1uch__:

Sequence, based on SEQRES records: (download)

>d1uch__ d.3.1.6 (-) Ubiquitin carboxyl-terminal hydrolase UCH-l3 {Human (Homo sapiens)}
rwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekyev
frteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfle
esvsmspeerarylenydairvthetsahegqteapsidekvdlhfialvhvdghlyeld
grkpfpinhgetsdetlledaievckkfmerdpdelrfnaialsaa

Sequence, based on observed residues (ATOM records): (download)

>d1uch__ d.3.1.6 (-) Ubiquitin carboxyl-terminal hydrolase UCH-l3 {Human (Homo sapiens)}
rwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekyev
frteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfle
esvsmspeerarylenydairvdlhfialvhvdghlyeldgrkpfpinhgetsdetlled
aievckkfmerdpdelrfnaialsaa

SCOP Domain Coordinates for d1uch__:

Click to download the PDB-style file with coordinates for d1uch__.
(The format of our PDB-style files is described here.)

Timeline for d1uch__: