Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (12 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-l3 [54050] (1 protein) |
Protein Ubiquitin carboxyl-terminal hydrolase UCH-l3 [54051] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54052] (2 PDB entries) |
Domain d1uch__: 1uch - [37129] |
PDB Entry: 1uch (more details), 1.8 Å
SCOP Domain Sequences for d1uch__:
Sequence, based on SEQRES records: (download)
>d1uch__ d.3.1.6 (-) Ubiquitin carboxyl-terminal hydrolase UCH-l3 {Human (Homo sapiens)} rwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekyev frteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfle esvsmspeerarylenydairvthetsahegqteapsidekvdlhfialvhvdghlyeld grkpfpinhgetsdetlledaievckkfmerdpdelrfnaialsaa
>d1uch__ d.3.1.6 (-) Ubiquitin carboxyl-terminal hydrolase UCH-l3 {Human (Homo sapiens)} rwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekyev frteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfle esvsmspeerarylenydairvdlhfialvhvdghlyeldgrkpfpinhgetsdetlled aievckkfmerdpdelrfnaialsaa
Timeline for d1uch__: