Lineage for d6ofgg_ (6ofg G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690748Superfamily a.2.20: MxiH-like [140129] (2 families) (S)
    Type III secretion system needle
  5. 2690759Family a.2.20.0: automated matches [193724] (1 protein)
    not a true family
  6. 2690760Protein automated matches [193725] (2 species)
    not a true protein
  7. 2690761Species Salmonella typhimurium [TaxId:216597] [193726] (3 PDB entries)
  8. 2690770Domain d6ofgg_: 6ofg G: [371206]
    automated match to d2x9cb_

Details for d6ofgg_

PDB Entry: 6ofg (more details), 2.9 Å

PDB Description: in vitro polymerized prgi v67a filaments
PDB Compounds: (G:) Protein prgI

SCOPe Domain Sequences for d6ofgg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ofgg_ a.2.20.0 (G:) automated matches {Salmonella typhimurium [TaxId: 216597]}
tpwsgylddvsakfdtgvdnlqtqvtealdklaakpsdpallaayqsklseynlyrnaqs
ntvkafkdidaaiiqnfr

SCOPe Domain Coordinates for d6ofgg_:

Click to download the PDB-style file with coordinates for d6ofgg_.
(The format of our PDB-style files is described here.)

Timeline for d6ofgg_: