Class a: All alpha proteins [46456] (290 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.20: MxiH-like [140129] (2 families) Type III secretion system needle |
Family a.2.20.0: automated matches [193724] (1 protein) not a true family |
Protein automated matches [193725] (2 species) not a true protein |
Species Salmonella typhimurium [TaxId:216597] [193726] (3 PDB entries) |
Domain d6ofgg_: 6ofg G: [371206] automated match to d2x9cb_ |
PDB Entry: 6ofg (more details), 2.9 Å
SCOPe Domain Sequences for d6ofgg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ofgg_ a.2.20.0 (G:) automated matches {Salmonella typhimurium [TaxId: 216597]} tpwsgylddvsakfdtgvdnlqtqvtealdklaakpsdpallaayqsklseynlyrnaqs ntvkafkdidaaiiqnfr
Timeline for d6ofgg_: