Lineage for d1fiea4 (1fie A:191-515)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 129971Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 129972Superfamily d.3.1: Cysteine proteinases [54001] (7 families) (S)
  5. 130125Family d.3.1.4: Transglutaminase catalytic domain [54044] (1 protein)
  6. 130126Protein Transglutaminase catalytic domain [54045] (2 species)
  7. 130127Species Human (Homo sapiens) [TaxId:9606] [54046] (7 PDB entries)
  8. 130134Domain d1fiea4: 1fie A:191-515 [37109]
    Other proteins in same PDB: d1fiea1, d1fiea2, d1fiea3, d1fieb1, d1fieb2, d1fieb3

Details for d1fiea4

PDB Entry: 1fie (more details), 2.5 Å

PDB Description: recombinant human coagulation factor xiii

SCOP Domain Sequences for d1fiea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fiea4 d.3.1.4 (A:191-515) Transglutaminase catalytic domain {Human (Homo sapiens)}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmygakkplntegvmksr

SCOP Domain Coordinates for d1fiea4:

Click to download the PDB-style file with coordinates for d1fiea4.
(The format of our PDB-style files is described here.)

Timeline for d1fiea4: