Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (26 species) not a true protein |
Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries) |
Domain d6nqrh1: 6nqr H:3-220 [370880] Other proteins in same PDB: d6nqra2, d6nqrc2, d6nqre2, d6nqrg2, d6nqrg3, d6nqrh2 automated match to d3srya_ mutant |
PDB Entry: 6nqr (more details), 2.9 Å
SCOPe Domain Sequences for d6nqrh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nqrh1 d.22.1.0 (H:3-220) automated matches {Echinophyllia sp. [TaxId: 301887]} vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfx nrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdgvn fpangpvmqkrtvkwepsteklyvrdgvlkgdvntalsleggghyrcdfkttykakkvvq lpdyhfvdhhieikshdkdysnvnlhehaeahsglp
Timeline for d6nqrh1: