Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Gluconobacter oxydans [TaxId:442] [370661] (2 PDB entries) |
Domain d6mywc_: 6myw C: [370667] automated match to d2r14a_ complexed with act, fmn, gol, na, so4; mutant |
PDB Entry: 6myw (more details), 1.16 Å
SCOPe Domain Sequences for d6mywc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mywc_ c.1.4.0 (C:) automated matches {Gluconobacter oxydans [TaxId: 442]} mptlfdpidfgpihaknrivmspltrgradkeavpapimaeyyaqrasagliiteatgis reglgwpfapgiwsdaqveawkpivagvhakggkivcqlwhmgrmvhssvtgtqpvsssa ttapgevhtyegkkpfeqaraidaadisrilndyenaarnairagfdgvqihaangylid eflrngtnhrtdeyggvpenrirflkevterviaaigadrtgvrlspngdtqgcidsape tvfvpaakllqdlgvawlelrepgpngtfgktdqpklspqirkvflrplvlnqdytfeaa qtalaegkadaiafgrkfisnpdlperfargialqpddmktwysqgpegytdypsa
Timeline for d6mywc_: