SCOPe 2.08: Domain d6jbtl2: 6jbt L:113-218

Lineage for d6jbtl2 (6jbt L:113-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6jbtl2: 6jbt L:113-218 [370432]
   Other proteins in same PDB: d6jbtf_
   automated match to d3aazb2
   complexed with nag

Details for d6jbtl2

PDB Entry: 6jbt, 2.47 Å

PDB Description: complex structure of toripalimab-fab and pd-1

PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d6jbtl2:

Sequence; same for both SEQRES and ATOM records:

>d6jbtl2 b.1.1.0 (L:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6jbtl2:

• d6jbtl2 first appeared in SCOPe 2.07