SCOPe 2.07: Domain d1mega_: 1meg A:

Lineage for d1mega_ (1meg A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Caricain (protease omega) [54007] (1 species)

7. Species Papaya (Carica papaya) [TaxId:3649] [54008] (3 PDB entries)

8. Domain d1mega_: 1meg A: [37021]
   complexed with e64, eoh; mutant

Details for d1mega_

PDB Entry: 1meg, 2 Å

PDB Description: crystal structure of a caricain d158e mutant in complex with e-64

PDB Compounds: (A:) caricain

SCOPe Domain Sequences for d1mega_:

Sequence; same for both SEQRES and ATOM records:

>d1mega_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]}
lpenvdwrkkgavtpvrhqgscgscwafsavatveginkirtgklvelseqelvdcerrs
hgckggyppyaleyvakngihlrskypykakqgtcrakqvggpivktsgvgrvqpnnegn
llnaiakqpvsvvveskgrpfqlykggifegpcgtkvehavtavgygksggkgyilikns
wgtawgekgyirikrapgnspgvcglykssyyptkn

Timeline for d1mega_:

• d1mega_ first appeared (with stable ids) in SCOP 1.55, called d1meg__
  
• d1mega_ appears in SCOPe 2.06
  
• d1mega_ appears in the current release, SCOPe 2.08