Lineage for d1ppoa_ (1ppo A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926785Protein Caricain (protease omega) [54007] (1 species)
  7. 2926786Species Papaya (Carica papaya) [TaxId:3649] [54008] (3 PDB entries)
  8. 2926788Domain d1ppoa_: 1ppo A: [37020]
    complexed with hg

Details for d1ppoa_

PDB Entry: 1ppo (more details), 1.8 Å

PDB Description: determination of the structure of papaya protease omega
PDB Compounds: (A:) protease omega

SCOPe Domain Sequences for d1ppoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]}
lpenvdwrkkgavtpvrhqgscgscwafsavatveginkirtgklvelseqelvdcerrs
hgckggyppyaleyvakngihlrskypykakqgtcrakqvggpivktsgvgrvqpnnegn
llnaiakqpvsvvveskgrpfqlykggifegpcgtkvdhavtavgygksggkgyilikns
wgtawgekgyirikrapgnspgvcglykssyyptkn

SCOPe Domain Coordinates for d1ppoa_:

Click to download the PDB-style file with coordinates for d1ppoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ppoa_: