SCOPe 2.07: Domain d6hrnb_: 6hrn B:

Lineage for d6hrnb_ (6hrn B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (20 species)
   not a true protein

7. Species Nostoc sp. [TaxId:1180] [370150] (1 PDB entry)

8. Domain d6hrnb_: 6hrn B: [370151]
   automated match to d1cpcb_
   complexed with cyc, mpd, no3, peg, pg4, pge, po4

Details for d6hrnb_

PDB Entry: 6hrn, 1.51 Å

PDB Description: c-phycocyanin from heterocyst forming filamentous cyanobacterium nostoc sp. wr13

PDB Compounds: (B:) Beta Subunit of Cyanobacterial Phycocyanin protein

SCOPe Domain Sequences for d6hrnb_:

Sequence; same for both SEQRES and ATOM records:

>d6hrnb_ a.1.1.3 (B:) automated matches {Nostoc sp. [TaxId: 1180]}
mldaftkvvsqadtrgayvsdaeidalkemvaagakrmdvvnritgnastivanaarglf
aeqpqliapggnaytnrrmaaclrdmeiilryvtyavfagdasvlddrclnglretyqal
gvpgasvatgvskmkeaaiaiandpngvtqgdcsslmaelgsyfdraaaavs

Timeline for d6hrnb_:

• d6hrnb_ is new in SCOPe 2.07-stable
  
• d6hrnb_ appears in the current release, SCOPe 2.08