Lineage for d6hgxa_ (6hgx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900441Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)
  6. 2900455Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)
  7. 2900456Species Human (Homo sapiens) [TaxId:9606] [102626] (49 PDB entries)
  8. 2900467Domain d6hgxa_: 6hgx A: [370124]
    automated match to d4c4za_
    complexed with g3t, mg

Details for d6hgxa_

PDB Entry: 6hgx (more details), 2.16 Å

PDB Description: soluble epoxide hydrolase in complex with 1-(4-((4-(tert-butyl) morpholin-2-yl)methoxy)phenyl)-3-cyclohexylurea
PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d6hgxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hgxa_ c.69.1.11 (A:) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrv
lamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfy
pervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfksl
frasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrn
mernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqm
dkptevnqilikwldsdar

SCOPe Domain Coordinates for d6hgxa_:

Click to download the PDB-style file with coordinates for d6hgxa_.
(The format of our PDB-style files is described here.)

Timeline for d6hgxa_: