Lineage for d6gt9b_ (6gt9 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520303Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2520304Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2520615Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2520616Protein automated matches [190646] (76 species)
    not a true protein
  7. 2520780Species Geobacillus stearothermophilus [TaxId:1422] [369939] (4 PDB entries)
  8. 2520784Domain d6gt9b_: 6gt9 B: [370054]
    automated match to d1guda_
    complexed with gal, so4

Details for d6gt9b_

PDB Entry: 6gt9 (more details), 1.89 Å

PDB Description: crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
PDB Compounds: (B:) Putative sugar binding protein

SCOPe Domain Sequences for d6gt9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gt9b_ c.93.1.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
ettkeayhfvlvpeeldndywrlvekgakaaakelgvdleyigprqanidehlrilkkaa
aakvdgiitqglteaefvpvineitdknipvvtidtdaptsrrvayvgtdnyyagflagr
alaedtkgkatvaiitgsltaahqqlrvrgfedavrqekgirivaieeshitrvqaaeka
ytilkkhpdvnafygtsaldaigvakvveqfhreqktyiigfdtlpetirylqkgtiaat
vvqepyemgykavkmmaeivagkdvpvvtntetkvirkkdlpl

SCOPe Domain Coordinates for d6gt9b_:

Click to download the PDB-style file with coordinates for d6gt9b_.
(The format of our PDB-style files is described here.)

Timeline for d6gt9b_: