Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.7: Chitosanase [53996] (2 proteins) automatically mapped to Pfam PF01374 |
Protein Endochitosanase [53997] (2 species) |
Species Streptomyces sp., strain N174 [TaxId:1931] [53998] (1 PDB entry) |
Domain d1chkb_: 1chk B: [37000] |
PDB Entry: 1chk (more details), 2.4 Å
SCOPe Domain Sequences for d1chkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1chkb_ d.2.1.7 (B:) Endochitosanase {Streptomyces sp., strain N174 [TaxId: 1931]} agaglddphkkeiamelvssaenssldwkaqykyiedigdgrgytggiigfcsgtgdmle lvqhytdlepgnilakylpalkkvngsashsglgtpftkdwataakdtvfqqaqnderdr vyfdpavsqakadglralgqfayydaivmhgpgndptsfggirktamkkartpaqggdet tylngfldarkaamlteaahddtsrvdteqrvflkagnldlnpplkwktygdpyvins
Timeline for d1chkb_: