Lineage for d1chkb_ (1chk B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926431Family d.2.1.7: Chitosanase [53996] (2 proteins)
    automatically mapped to Pfam PF01374
  6. 2926432Protein Endochitosanase [53997] (2 species)
  7. 2926437Species Streptomyces sp., strain N174 [TaxId:1931] [53998] (1 PDB entry)
  8. 2926439Domain d1chkb_: 1chk B: [37000]

Details for d1chkb_

PDB Entry: 1chk (more details), 2.4 Å

PDB Description: streptomyces n174 chitosanase ph5.5 298k
PDB Compounds: (B:) Chitosanase

SCOPe Domain Sequences for d1chkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chkb_ d.2.1.7 (B:) Endochitosanase {Streptomyces sp., strain N174 [TaxId: 1931]}
agaglddphkkeiamelvssaenssldwkaqykyiedigdgrgytggiigfcsgtgdmle
lvqhytdlepgnilakylpalkkvngsashsglgtpftkdwataakdtvfqqaqnderdr
vyfdpavsqakadglralgqfayydaivmhgpgndptsfggirktamkkartpaqggdet
tylngfldarkaamlteaahddtsrvdteqrvflkagnldlnpplkwktygdpyvins

SCOPe Domain Coordinates for d1chkb_:

Click to download the PDB-style file with coordinates for d1chkb_.
(The format of our PDB-style files is described here.)

Timeline for d1chkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1chka_