PDB entry 1chk

View 1chk on RCSB PDB site
Description: streptomyces n174 chitosanase ph5.5 298k
Class: hydrolase (o-glycosyl)
Keywords: anti-fungal protein, hydrolase, o-glycosyl, hydrolase (o-glycosyl)
Deposited on 1995-06-12, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.181
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitosanase
    Species: Streptomyces sp. [TaxId:69019]
    Gene: CSN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33665 (0-237)
      • conflict (184)
    Domains in SCOPe 2.07: d1chka_
  • Chain 'B':
    Compound: Chitosanase
    Species: Streptomyces sp. [TaxId:69019]
    Gene: CSN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33665 (0-237)
      • conflict (184)
    Domains in SCOPe 2.07: d1chkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chkA (A:)
    agaglddphkkeiamelvssaenssldwkaqykyiedigdgrgytggiigfcsgtgdmle
    lvqhytdlepgnilakylpalkkvngsashsglgtpftkdwataakdtvfqqaqnderdr
    vyfdpavsqakadglralgqfayydaivmhgpgndptsfggirktamkkartpaqggdet
    tylngfldarkaamlteaahddtsrvdteqrvflkagnldlnpplkwktygdpyvins
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chkB (B:)
    agaglddphkkeiamelvssaenssldwkaqykyiedigdgrgytggiigfcsgtgdmle
    lvqhytdlepgnilakylpalkkvngsashsglgtpftkdwataakdtvfqqaqnderdr
    vyfdpavsqakadglralgqfayydaivmhgpgndptsfggirktamkkartpaqggdet
    tylngfldarkaamlteaahddtsrvdteqrvflkagnldlnpplkwktygdpyvins