SCOPe 2.08: Domain d6gk4c1: 6gk4 C:6-118

Lineage for d6gk4c1 (6gk4 C:6-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)

8. Domain d6gk4c1: 6gk4 C:6-118 [369976]
   Other proteins in same PDB: d6gk4a_, d6gk4b2, d6gk4c2, d6gk4d_, d6gk4e2, d6gk4f2
   automated match to d4nbzb_
   complexed with atp, gol, mg

Details for d6gk4c1

PDB Entry: 6gk4, 2.91 Å

PDB Description: human nbd1 of cftr in complex with nanobodies d12 and t8

PDB Compounds: (C:) Nanobody T8

SCOPe Domain Sequences for d6gk4c1:

Sequence, based on SEQRES records:

>d6gk4c1 b.1.1.0 (C:6-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgstssinamgwyrqapgkqrepvaisssggdtryaepvkg
rftisrdnaqnkvylqmnslkpedtavyycwlnwgrtsvnswgqgtqvtvssa

Sequence, based on observed residues (ATOM records):

>d6gk4c1 b.1.1.0 (C:6-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaassinamgwyrqapgkqrepvaisssggdtryaepvkgrfti
srdnaqnkvylqmnslkpedtavyycwlnwgrtsvnswgqgtqvtvssa

Timeline for d6gk4c1:

• d6gk4c1 first appeared in SCOPe 2.07