PDB entry 6gk4

View 6gk4 on RCSB PDB site
Description: Human NBD1 of CFTR in complex with nanobodies D12 and T8
Class: hydrolase
Keywords: Cystic Fibrosis, CFTR, nanobodies, thermal stabilization, conformational dynamics, Hydrolase
Deposited on 2018-05-18, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gk4a_
  • Chain 'B':
    Compound: Nanobody D12
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GK4 (0-End)
    Domains in SCOPe 2.07: d6gk4b1, d6gk4b2
  • Chain 'C':
    Compound: Nanobody T8
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GK4 (0-End)
    Domains in SCOPe 2.07: d6gk4c1, d6gk4c2
  • Chain 'D':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gk4d_
  • Chain 'E':
    Compound: Nanobody D12
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GK4 (0-End)
    Domains in SCOPe 2.07: d6gk4e1, d6gk4e2
  • Chain 'F':
    Compound: Nanobody T8
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GK4 (0-End)
    Domains in SCOPe 2.07: d6gk4f1, d6gk4f2
  • Heterogens: GOL, MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gk4A (A:)
    sltttevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelep
    segkikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekd
    nivlgeggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklman
    ktrilvtskmehlkkadkililhegssyfygtfselqnlqpdfssklmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gk4A (A:)
    tevvmenvtafwpvlkdinfkiergqllavagstgagktsllmmimgelepsegkikhsg
    risfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdnivlgeggi
    tlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktrilvtsk
    mehlkkadkililhegssyfygtfselqnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gk4B (B:)
    qvqlqesggglvqagsslrlacaatgsirsinnmgwyrqapgkqrgmvaiitrvgntdya
    dsvkgrftisrdnakntvylqmnslkpedtatyychaeiteqsrpfyltddywgqgtqvt
    vssaaahhhhhhgaaeqkliseedlngaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gk4B (B:)
    qvqlqesggglvqagsslrlacaatgsirsinnmgwyrqapgkqrgmvaiitrvgntdya
    dsvkgrftisrdnakntvylqmnslkpedtatyychaeiteqsrpfyltddywgqgtqvt
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gk4C (C:)
    qvqlqesggglvqpggslrlscaasgstssinamgwyrqapgkqrepvaisssggdtrya
    epvkgrftisrdnaqnkvylqmnslkpedtavyycwlnwgrtsvnswgqgtqvtvssaaa
    hhhhhhgaaeqkliseedlngaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gk4C (C:)
    qvqlqesggglvqpggslrlscaassinamgwyrqapgkqrepvaisssggdtryaepvk
    grftisrdnaqnkvylqmnslkpedtavyycwlnwgrtsvnswgqgtqvtvssa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gk4D (D:)
    sltttevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelep
    segkikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekd
    nivlgeggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklman
    ktrilvtskmehlkkadkililhegssyfygtfselqnlqpdfssklmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gk4D (D:)
    ttevvmenvtafwpvlkdinfkiergqllavagstgagktsllmmimgelepsegkikhs
    grisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdnivlgegg
    itlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktrilvts
    kmehlkkadkililhegssyfygtfselqnl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6gk4E (E:)
    qvqlqesggglvqagsslrlacaatgsirsinnmgwyrqapgkqrgmvaiitrvgntdya
    dsvkgrftisrdnakntvylqmnslkpedtatyychaeiteqsrpfyltddywgqgtqvt
    vssaaahhhhhhgaaeqkliseedlngaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gk4E (E:)
    qvqlqesggglvqagsslrlacaatgsirsinnmgwyrqapgkqrgmvaiitrvgntdya
    dsvkgrftisrdnakntvylqmnslkpedtatyychaeiteqsrpfyltddywgqgtqvt
    vs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6gk4F (F:)
    qvqlqesggglvqpggslrlscaasgstssinamgwyrqapgkqrepvaisssggdtrya
    epvkgrftisrdnaqnkvylqmnslkpedtavyycwlnwgrtsvnswgqgtqvtvssaaa
    hhhhhhgaaeqkliseedlngaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gk4F (F:)
    qvqlqesggglvqpggslrlscaassinamgwyrqapgkqrepvaisssggdtryaepvk
    grftisrdnaqnkvylqmnslkpedtavyycwlnwgrtsvnswgqgtqvtvssaaa