SCOPe 2.08: Domain d6aexu2: 6aex U:186-274

Lineage for d6aexu2 (6aex U:186-274)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.0: automated matches [191613] (1 protein)
   not a true family

6. Protein automated matches [191119] (7 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255821] (2 PDB entries)

8. Domain d6aexu2: 6aex U:186-274 [369582]
   automated match to d3u74u3
   complexed with nag

Details for d6aexu2

PDB Entry: 6aex, 2.39 Å

PDB Description: crystal structure of unoccupied murine upar

PDB Compounds: (U:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d6aexu2:

Sequence, based on SEQRES records:

>d6aexu2 g.7.1.0 (U:186-274) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ppngfqcyscegnntlgcsseeaslincrgpmnqclvatgldvlgnrsytvrgcataswc
qgshvadsfpthlnvsvscchgsgcnspt

Sequence, based on observed residues (ATOM records):

>d6aexu2 g.7.1.0 (U:186-274) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ppngfqcyscegcsseeaslincrgpmnqclvatglsytvrgcataswcqgshvadsfpt
hlnvsvscchgsgcnspt

Timeline for d6aexu2:

• d6aexu2 first appeared in SCOPe 2.07