| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
| Family d.2.1.3: Phage lysozyme [53981] (4 proteins) |
| Protein Phage T4 lysozyme [53982] (1 species) |
| Species Bacteriophage T4 [TaxId:10665] [53983] (525 PDB entries) Uniprot P00720 many mutant structures |
| Domain d150lb_: 150l B: [36949] |
PDB Entry: 150l (more details), 2.2 Å
SCOPe Domain Sequences for d150lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d150lb_ d.2.1.3 (B:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifeilrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk
Timeline for d150lb_: