Lineage for d216la_ (216l A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 129072Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 129073Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 129554Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins)
  6. 129555Protein Phage T4 lysozyme [53982] (1 species)
  7. 129556Species Bacteriophage T4 [TaxId:10665] [53983] (349 PDB entries)
  8. 129888Domain d216la_: 216l A: [36940]

Details for d216la_

PDB Entry: 216l (more details), 2.1 Å

PDB Description: structural basis of alpha-helix propensity at two sites in t4 lysozyme

SCOP Domain Sequences for d216la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d216la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakweldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOP Domain Coordinates for d216la_:

Click to download the PDB-style file with coordinates for d216la_.
(The format of our PDB-style files is described here.)

Timeline for d216la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d216lb_