Lineage for d6hg6a_ (6hg6 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. Protein automated matches [190793] (30 species)
    not a true protein
  7. Species Clostridium beijerinckii [TaxId:1520] [369345] (1 PDB entry)
  8. Domain d6hg6a_: 6hg6 A: [369346]
    automated match to d5t79a_
    complexed with edo, ndp

Details for d6hg6a_

PDB Entry: 6hg6 (more details), 1.7500000000000002 Å

PDB Description: clostridium beijerinckii aldo-keto reductase cbei_3974 with nadph
PDB Compounds: (A:) L-glyceraldehyde 3-phosphate reductase

SCOPe Domain Sequences for d6hg6a_:

Sequence, based on SEQRES records: (download)

>d6hg6a_ c.1.7.0 (A:) automated matches {Clostridium beijerinckii [TaxId: 1520]}
kyqasknrynemkyskcgesglklpmisfglwhnfgsnadynnmkelcftafdngithfd
lannygpvpgsaeenfgrilrddlatyrdellistkagykmwegpygdfgsrkyilasld
qslkrmgleyvdifyhhrmdpdtpleesmmaldtavksgkalyagisnyngetmekaaai
lnelkcpfvinqnrysifdrtiennglkraakengkgiiafsplaqgtltdkylsgipdd
srikvdgrflkqdiltekkleqirrlnnialnrgqtlaqmalswvlkdsevtsvligask
psqiienvgivhkigftdeelmmideisan

Sequence, based on observed residues (ATOM records): (download)

>d6hg6a_ c.1.7.0 (A:) automated matches {Clostridium beijerinckii [TaxId: 1520]}
kyqasknrynemkyskcgesglklpmisfglwhnfgsnadynnmkelcftafdngithfd
lannygpvpgsaeenfgrilrddlatyrdellistkagykmwegpygdfgsrkyilasld
qslkrmgleyvdifyhhrmdpdtpleesmmaldtavksgkalyagisnyngetmekaaai
lnelkcpfvinqnrysifdrtiennglkraakengkgiiafsplaqgtltdkylsgilte
kkleqirrlnnialnrgqtlaqmalswvlkdsevtsvligaskpsqiienvgivhkigft
deelmmideisan

SCOPe Domain Coordinates for d6hg6a_ are not available.

Timeline for d6hg6a_: