PDB entry 6hg6

View 6hg6 on RCSB PDB site
Description: Clostridium beijerinckii aldo-keto reductase Cbei_3974 with NADPH
Class: oxidoreductase
Keywords: Aldo keto reductase, AKR, Clostridium beijerinckii, Cbei_3974, aldehyde reductase, methylglyoxal, TIM barrel, NADPH, furfural resistance, 3D Structure determination, OXIDOREDUCTASE
Deposited on 2018-08-22, released 2019-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-glyceraldehyde 3-phosphate reductase
    Species: Clostridium beijerinckii [TaxId:1520]
    Gene: gpr_2, CBEIJ_11710
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hg6a_
  • Heterogens: NDP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hg6A (A:)
    mkyqasknrynemkyskcgesglklpmisfglwhnfgsnadynnmkelcftafdngithf
    dlannygpvpgsaeenfgrilrddlatyrdellistkagykmwegpygdfgsrkyilasl
    dqslkrmgleyvdifyhhrmdpdtpleesmmaldtavksgkalyagisnyngetmekaaa
    ilnelkcpfvinqnrysifdrtiennglkraakengkgiiafsplaqgtltdkylsgipd
    dsrikvdgrflkqdiltekkleqirrlnnialnrgqtlaqmalswvlkdsevtsvligas
    kpsqiienvgivhkigftdeelmmideisan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hg6A (A:)
    kyqasknrynemkyskcgesglklpmisfglwhnfgsnadynnmkelcftafdngithfd
    lannygpvpgsaeenfgrilrddlatyrdellistkagykmwegpygdfgsrkyilasld
    qslkrmgleyvdifyhhrmdpdtpleesmmaldtavksgkalyagisnyngetmekaaai
    lnelkcpfvinqnrysifdrtiennglkraakengkgiiafsplaqgtltdkylsgilte
    kkleqirrlnnialnrgqtlaqmalswvlkdsevtsvligaskpsqiienvgivhkigft
    deelmmideisan