Lineage for d6nqia_ (6nqi A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887238Species Cyanidioschyzon merolae [TaxId:280699] [369149] (1 PDB entry)
  8. 2887239Domain d6nqia_: 6nqi A: [369156]
    automated match to d4jkbb_
    complexed with bme

Details for d6nqia_

PDB Entry: 6nqi (more details), 2.75 Å

PDB Description: prp8 rh domain from c. merolae
PDB Compounds: (A:) Pre-mRNA splicing factor PRP8

SCOPe Domain Sequences for d6nqia_:

Sequence, based on SEQRES records: (download)

>d6nqia_ c.55.3.0 (A:) automated matches {Cyanidioschyzon merolae [TaxId: 280699]}
gdlwrqrlwivddrtayrphangviwiwetstgrlfvkivhrttwagqtrraqlakwkca
ehvltmlrsqpteelprgivlaqtasmdplktllagteyakipvragaaamplqalmalp
eirdrtqtarsselsiwsgyadwlehvpvwiasarfllllhaldrapervlqlvwpqrsa
deesagsatpwlwpalpetdwrrlelelq

Sequence, based on observed residues (ATOM records): (download)

>d6nqia_ c.55.3.0 (A:) automated matches {Cyanidioschyzon merolae [TaxId: 280699]}
gdlwrqrlwivddrtayrphangviwiwetstgrlfvkivhrttwagqtrraqlakwkca
ehvltmlrsqpteelprgivlaqtasmdplktllagteyakipvragaaamplqalmalp
eirdrtqtarsselsiwsgyadwlehvpvwiasarfllllhaldrapervlqlvwtpwlw
palpetdwrrlelelq

SCOPe Domain Coordinates for d6nqia_:

Click to download the PDB-style file with coordinates for d6nqia_.
(The format of our PDB-style files is described here.)

Timeline for d6nqia_: