Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Cyanidioschyzon merolae [TaxId:280699] [369149] (1 PDB entry) |
Domain d6nqia_: 6nqi A: [369156] automated match to d4jkbb_ complexed with bme |
PDB Entry: 6nqi (more details), 2.75 Å
SCOPe Domain Sequences for d6nqia_:
Sequence, based on SEQRES records: (download)
>d6nqia_ c.55.3.0 (A:) automated matches {Cyanidioschyzon merolae [TaxId: 280699]} gdlwrqrlwivddrtayrphangviwiwetstgrlfvkivhrttwagqtrraqlakwkca ehvltmlrsqpteelprgivlaqtasmdplktllagteyakipvragaaamplqalmalp eirdrtqtarsselsiwsgyadwlehvpvwiasarfllllhaldrapervlqlvwpqrsa deesagsatpwlwpalpetdwrrlelelq
>d6nqia_ c.55.3.0 (A:) automated matches {Cyanidioschyzon merolae [TaxId: 280699]} gdlwrqrlwivddrtayrphangviwiwetstgrlfvkivhrttwagqtrraqlakwkca ehvltmlrsqpteelprgivlaqtasmdplktllagteyakipvragaaamplqalmalp eirdrtqtarsselsiwsgyadwlehvpvwiasarfllllhaldrapervlqlvwtpwlw palpetdwrrlelelq
Timeline for d6nqia_: