Lineage for d1dyca_ (1dyc A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1190374Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1190375Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1191083Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 1191089Protein Phage T4 lysozyme [53982] (1 species)
  7. 1191090Species Bacteriophage T4 [TaxId:10665] [53983] (525 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 1191535Domain d1dyca_: 1dyc A: [36903]
    complexed with bme, cl

Details for d1dyca_

PDB Entry: 1dyc (more details), 2.1 Å

PDB Description: determination of alpha-helix propensity within the context of a folded protein: sites 44 and 131 in bacteriophage t4 lysozyme
PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d1dyca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyca_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaainlaksrwynqtpnrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d1dyca_:

Click to download the PDB-style file with coordinates for d1dyca_.
(The format of our PDB-style files is described here.)

Timeline for d1dyca_: