Lineage for d6qmnc_ (6qmn C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928145Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. 2928146Species Bison bison [TaxId:9901] [368719] (1 PDB entry)
  8. 2928149Domain d6qmnc_: 6qmn C: [368720]
    automated match to d3rida_
    complexed with po4

Details for d6qmnc_

PDB Entry: 6qmn (more details), 2.31 Å

PDB Description: crystal structure of a ribonuclease a-onconase chimera
PDB Compounds: (C:) ribonuclease pancreatic

SCOPe Domain Sequences for d6qmnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qmnc_ d.5.1.1 (C:) Ribonuclease A (also ribonuclease B, S) {Bison bison [TaxId: 9901]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacenqapvhfda
sv

SCOPe Domain Coordinates for d6qmnc_:

Click to download the PDB-style file with coordinates for d6qmnc_.
(The format of our PDB-style files is described here.)

Timeline for d6qmnc_: