| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
| Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
| Protein automated matches [191036] (17 species) not a true protein |
| Species Mycobacterium smegmatis [TaxId:246196] [368261] (8 PDB entries) |
| Domain d5zrob_: 5zro B: [368267] automated match to d3eeua_ complexed with 523, edo |
PDB Entry: 5zro (more details), 1.41 Å
SCOPe Domain Sequences for d5zrob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zrob_ d.113.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mtkqivvagalisrgtllvaqrdrpaelaglwelpggkvtpgesdadalarelreelgvd
vavgerlgadvalndamtlrayrvtlrsgsphphdhralrwvgadeidglawvpadrawv
pdlvaalsg
Timeline for d5zrob_: