SCOPe 2.08: Domain d5zrob_: 5zro B:

Lineage for d5zrob_ (5zro B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.0: automated matches [191580] (1 protein)
   not a true family

6. Protein automated matches [191036] (17 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [368261] (8 PDB entries)

8. Domain d5zrob_: 5zro B: [368267]
   automated match to d3eeua_
   complexed with 523, edo

Details for d5zrob_

PDB Entry: 5zro, 1.41 Å

PDB Description: m. smegmatis antimutator protein mutt2 in complex with 5mdctp

PDB Compounds: (B:) Putative mutator protein MutT2/NUDIX hydrolase

SCOPe Domain Sequences for d5zrob_:

Sequence; same for both SEQRES and ATOM records:

>d5zrob_ d.113.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mtkqivvagalisrgtllvaqrdrpaelaglwelpggkvtpgesdadalarelreelgvd
vavgerlgadvalndamtlrayrvtlrsgsphphdhralrwvgadeidglawvpadrawv
pdlvaalsg

Timeline for d5zrob_:

• d5zrob_ first appeared in SCOPe 2.07