PDB entry 5zro

View 5zro on RCSB PDB site
Description: M. smegmatis antimutator protein MutT2 in complex with 5mdCTP
Class: hydrolase
Keywords: Nudix hydrolase, MutT, antimutator, CTP pyrophosphorylase, 5mdCTP, HYDROLASE
Deposited on 2018-04-24, released 2019-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative mutator protein MutT2/NUDIX hydrolase
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: mutT2, MSMEI_5016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zroa_
  • Chain 'B':
    Compound: Putative mutator protein MutT2/NUDIX hydrolase
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: mutT2, MSMEI_5016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zrob_
  • Heterogens: 523, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zroA (A:)
    mgsshhhhhhssglvprgshmtkqivvagalisrgtllvaqrdrpaelaglwelpggkvt
    pgesdadalarelreelgvdvavgerlgadvalndamtlrayrvtlrsgsphphdhralr
    wvgadeidglawvpadrawvpdlvaalsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zroA (A:)
    mtkqivvagalisrgtllvaqrdrpaelaglwelpggkvtpgesdadalarelreelgvd
    vavgerlgadvalndamtlrayrvtlrsgsphphdhralrwvgadeidglawvpadrawv
    pdlvaals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zroB (B:)
    mgsshhhhhhssglvprgshmtkqivvagalisrgtllvaqrdrpaelaglwelpggkvt
    pgesdadalarelreelgvdvavgerlgadvalndamtlrayrvtlrsgsphphdhralr
    wvgadeidglawvpadrawvpdlvaalsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zroB (B:)
    mtkqivvagalisrgtllvaqrdrpaelaglwelpggkvtpgesdadalarelreelgvd
    vavgerlgadvalndamtlrayrvtlrsgsphphdhralrwvgadeidglawvpadrawv
    pdlvaalsg