Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (91 species) not a true protein |
Species Escherichia coli [TaxId:83333] [367689] (3 PDB entries) |
Domain d6ofuc_: 6ofu C: [368255] automated match to d3q94a_ complexed with cl, zn |
PDB Entry: 6ofu (more details), 1.75 Å
SCOPe Domain Sequences for d6ofuc_:
Sequence, based on SEQRES records: (download)
>d6ofuc_ c.1.10.0 (C:) automated matches {Escherichia coli [TaxId: 83333]} mladirywendatnkhyaiahfnvwnaemlmgvidaaeeakspviisfgtgfvgntsfed fshmmvsmaqkatvpvithwdhgrsmeiihnawthgmnslmrdasafdfeenirltkeav dffhplgipveaelghvgnetvyeealagyhytdpdqaaefvertgcdslavaignqhgv ytsepqlnfevvkrvrdavsvplvlhgasgisdadiktaislgiakinihtelcqaamva vkenqdqpflhlerevrkavkeralekiklfgsdgkae
>d6ofuc_ c.1.10.0 (C:) automated matches {Escherichia coli [TaxId: 83333]} mladirywendatnkhyaiahfnvwnaemlmgvidaaeeakspviisfgtgfvgntsfed fshmmvsmaqkatvpvithwdhgrsmeiihnawthgmnslmrdasafdfeenirltkeav dffhplgipveaelghvgnetvyeealytdpdqaaefvertgcdslavailnfevvkrvr davsvplvlhgasgisdadiktaislgiakinihtelcqaamvavkenqdqpflhlerev rkavkeralekiklfgsdgkae
Timeline for d6ofuc_: