Lineage for d192la_ (192l A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. Protein Phage T4 lysozyme [53982] (1 species)
  7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
    Uniprot P00720
    many mutant structures
  8. Domain d192la_: 192l A: [36815]
    complexed with cl, hed

Details for d192la_

PDB Entry: 192l (more details), 1.9 Å

PDB Description: a helix initiation signal in t4 lysozyme identified by polyalanine mutagenesis
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d192la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d192la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslaaakaalaaaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwaaaaaalaksrwynqtpnrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d192la_ are not available.

Timeline for d192la_: